Reaction Details |
| Report a problem with these data |
Target | Hematopoietic prostaglandin D synthase |
---|
Ligand | BDBM179425 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Fluorescence Polarization Binding Assay (FPBA) |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 450±n/a nM |
---|
Comments | extracted |
---|
Citation | Endres, GW; Lee, PH; Olson, KL; Kramer, JB; Ciske, FL; Barrett, SD Multiheteroaryl compounds as inhibitors of H-PGDS and their use for treating prostaglandin D2 mediated diseases US Patent US9126973 Publication Date 9/8/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Hematopoietic prostaglandin D synthase |
---|
Name: | Hematopoietic prostaglandin D synthase |
Synonyms: | GSTS | Glutathione-dependent PGD synthetase | Glutathione-requiring prostaglandin D synthase | H-PGDS | HPGDS | HPGDS_HUMAN | Hematopoietic prostaglandin D synthase | Hematopoietic prostaglandin D synthase (H-PGDS) | Hematopoietic prostaglandin D synthase (HPGDS) | PGDS | PTGDS2 | Prostaglandin D | Prostaglandin D Synthase |
Type: | Enzyme |
Mol. Mass.: | 23341.07 |
Organism: | Homo sapiens (Human) |
Description: | The protein was expressed in E. coli strain BL21(DE3) with an N-terminal 6-His tag. |
Residue: | 199 |
Sequence: | MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
|
|
|
BDBM179425 |
---|
n/a |
---|
Name | BDBM179425 |
Synonyms: | US9126973, 20 |
Type | Small organic molecule |
Emp. Form. | C24H22N6O |
Mol. Mass. | 410.4711 |
SMILES | O=C(N1CCC(CC1)c1nc(c[nH]1)-c1cnc(nc1)-c1ccccc1)c1cccnc1 |
Structure |
|