Reaction Details |
| Report a problem with these data |
Target | Potassium channel subfamily K member 3 |
---|
Ligand | BDBM179702 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Biological Assay |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 64±n/a nM |
---|
Comments | extracted |
---|
Citation | Bialy, L; Lorenz, K; Wirth, K; Steinmeyer, K; Hessler, G; Pernerstorfer, J; Brendel, J Substituted 4,5,6,7-tetrahydro-1H-pyrazolo[4,3-c]pyridines, their use as medicament, and pharmaceutical preparations comprising them US Patent US9127001 Publication Date 9/8/2015 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Potassium channel subfamily K member 3 |
---|
Name: | Potassium channel subfamily K member 3 |
Synonyms: | Acid-sensitive potassium channel TASK-1 | Acid-sensitive potassium channel protein TASK-1 | KCNK3 | KCNK3_HUMAN | Potassium channel protein TASK-1 | Potassium channel subfamily K member 3 | Potassium channel subfamily K member 3 (TASK-1) | TASK | TASK1 | TWIK-related acid-sensitive K(+) channel 1 | Two pore K(+) channel KT3.1 | Two pore potassium channel KT3.1 |
Type: | Protein |
Mol. Mass.: | 43534.71 |
Organism: | Homo sapiens (Human) |
Description: | O14649 |
Residue: | 394 |
Sequence: | MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPELIERQRLELRQQELRARYNLSQGGYE
ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLGIPL
TLVMFQSLGERINTLVRYLLHRAKKGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSH
YEHWTFFQAYYYCFITLTTIGFGDYVALQKDQALQTQPQYVAFSFVYILTGLTVIGAFLN
LVVLRFMTMNAEDEKRDAEHRALLTRNGQAGGGGGGGSAHTTDTASSTAAAGGGGFRNVY
AEVLHFQSMCSCLWYKSREKLQYSIPMIIPRDLSTSDTCVEQSHSSPGGGGRYSDTPSRR
CLCSGAPRSAISSVSTGLHSLSTFRGLMKRRSSV
|
|
|
BDBM179702 |
---|
n/a |
---|
Name | BDBM179702 |
Synonyms: | US9127001, 8i | US9598410, Compound 8i |
Type | Small organic molecule |
Emp. Form. | C25H22F2N4O |
Mol. Mass. | 432.4652 |
SMILES | Fc1ccc(Cn2nc(c3CN(CCc23)C(=O)C2CCC2)-c2cccc(c2)C#N)c(F)c1 |
Structure |
|