| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Adenosine receptor A1 |
|---|
| Ligand | BDBM181010 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Competition Binding Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| Ki | 51±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Cabri, W; Minetti, P; Piersanti, G; Tarzia, G Oxidated derivatives of triazolylpurines useful as ligands of the adenosine A2A receptor and their use as medicaments US Patent US9133197 Publication Date 9/15/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Adenosine receptor A1 |
|---|
| Name: | Adenosine receptor A1 |
|---|
| Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 36520.92 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30542 |
|---|
| Residue: | 326 |
|---|
| Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
|---|
| BDBM181010 |
|---|
| n/a |
|---|
| Name | BDBM181010 |
|---|
| Synonyms: | US9133197, 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H16N8O |
|---|
| Mol. Mass. | 288.3084 |
|---|
| SMILES | Cn1c(nc2c(N)nc(CCCCO)nc12)-n1nccn1 |
|---|
| Structure | 
|
|---|
Search and Browse
