Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetbeta-Hydroxyacyl-acyl carrier protein dehydratase (FtFabZ)
LigandBDBM11318
Substrate/Competitorn/a
Meas. Tech.FabZ Inhibition Assay
pH7±n/a
Temperature298.15±n/a K
IC50 4.31e+4± 9.2e+3 nM
Commentsextracted
Citation McGillick BEKumaran DVieni CSwaminathan S -Hydroxyacyl-acyl Carrier Protein Dehydratase (FabZ) from Francisella tularensis and Yersinia pestis: Structure Determination, Enzymatic Characterization, and Cross-Inhibition Studies. Biochemistry 55:1091-9 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
beta-Hydroxyacyl-acyl carrier protein dehydratase (FtFabZ)
Name:beta-Hydroxyacyl-acyl carrier protein dehydratase (FtFabZ)
Synonyms:n/a
Type:Protein
Mol. Mass.:18151.57
Organism:Francisella tularensis
Description:n/a
Residue:163
Sequence:
MSQFNQNNKQIDVMGIRKILPHRYPFALLDKIVDWSVEDRTIVAQKNVTINEDFFNGHFP
DFPVMPGVLIVEAMAQATAILGELMAETLFAHVVEKAGGGRRTFMLAGIDKVRVKRPVVP
GDVLVIESRMVKQKNIICTAESVAKVDGQIVCSAELMAAYKDY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11318
n/a
NameBDBM11318
Synonyms:1,3,8-trihydroxy-6-methyl-9,10-dihydroanthracene-9,10-dione | 1,3,8-trihydroxy-6-methylanthra-9,10-quinone | CHEMBL289277 | Emodin
TypeSmall organic molecule
Emp. Form.C15H10O5
Mol. Mass.270.2369
SMILESCc1cc(O)c2C(=O)c3c(O)cc(O)cc3C(=O)c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: