Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor
LigandBDBM86806
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
Ki>2000±n/a nM
Citation Carroll FIOndachi PWNavarro HADamaj MIWoods JHJutkiewicz EM Nicotinic receptor compounds US Patent  US9150581 Publication Date 10/6/2015
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor
Name:Neuronal acetylcholine receptor
Synonyms:Cholinergic, Nicotinic Alpha7 | Cholinergic, Nicotinic Alpha7/5-HT3 | Neuronal acetylcholine receptor (alpha7 nAChR) | Neuronal acetylcholine receptor subunit alpha 7 | Neuronal acetylcholine receptor subunit alpha-7 | Neuronal acetylcholine receptor subunit alpha-7 (nAChR alpha7) | Neuronal acetylcholine receptor subunit alpha-7 (nAChR)
Type:Enzyme
Mol. Mass.:56502.44
Organism:Rattus norvegicus (Rat)
Description:Q05941
Residue:502
Sequence:
MCGGRGGIWLALAAALLHVSLQGEFQRRLYKELVKNYNPLERPVANDSQPLTVYFSLSLL
QIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADE
RFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDL
QMQEADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIP
CVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFAST
MIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILLNWCAWFLRMKRPGEDKVRPACQHK
PRRCSLASVELSAGAGPPTSNGNLLYIGFRGLEGMHCAPTPDSGVVCGRLACSPTHDEHL
MHGAHPSDGDPDLAKILEEVRYIANRFRCQDESEVICSEWKFAACVVDRLCLMAFSVFTI
ICTIGILMSAPNFVEAVSKDFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM86806
n/a
NameBDBM86806
Synonyms:CAS_45263762 | NSC_45263762 | US9150581, RTI-7527-(-)-47 | rac-2-(6-fluoro-5-phenylpyridin-3-yl)-7-aza-bicyclo[2.2.1]heptane hydrochloride
TypeSmall organic molecule
Emp. Form.C17H17FN2
Mol. Mass.268.3287
SMILESFc1ncc(cc1-c1ccccc1)C1CC2CCC1N2 |TLB:4:13:16.17:19|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: