Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFerrochelatase R115L (FECH)
LigandBDBM185147
Substrate/Competitorn/a
Meas. Tech.Competition Binding Assays
Kd 3.4e+3± 0 nM
Citation Klaeger SGohlke BPerrin JGupta VHeinzlmeir SHelm DQiao HBergamini GHanda HSavitski MMBantscheff MMédard GPreissner RKuster B Chemical Proteomics Reveals Ferrochelatase as a Common Off-target of Kinase Inhibitors. ACS Chem Biol 11:1245-54 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ferrochelatase R115L (FECH)
Name:Ferrochelatase R115L (FECH)
Synonyms:n/a
Type:Protein
Mol. Mass.:47832.73
Organism:Homo sapiens (Human)
Description:Mutant R115L used for experiment
Residue:423
Sequence:
MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQV
QPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRLTPKIQ
EQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERD
GLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADH
ILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLV
WQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKEC
GVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTS
QQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM185147
n/a
NameBDBM185147
Synonyms:(Z)-but-2-enedioic acid;8-(6-methoxypyridin-3-yl)-3-methyl-1-[4-piperazin-1-yl-3-(trifluoromethyl)phenyl]imidazo[4,5-c]quinolin-2-one | BGT-226 | US9284315, BGT-226
TypeSmall organic molecule
Emp. Form.C28H25F3N6O2
Mol. Mass.534.5323
SMILESCOc1ccc(cn1)-c1ccc2ncc3n(C)c(=O)n(-c4ccc(N5CCNCC5)c(c4)C(F)(F)F)c3c2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: