Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTransglutaminases (TGase)
LigandBDBM185752
Substrate/Competitorn/a
Meas. Tech.Enzyme Inhibition Assay
IC50 48000±6000 nM
Citation Pardin CKeillor JWLubell WD Cinnamoyl inhibitors of transglutaminase US Patent  US9162991 Publication Date 10/20/2015
More Info.:Get all data from this article,  Assay Method
 
Transglutaminases (TGase)
Name:Transglutaminases (TGase)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:77122.36
Organism:Cavia cutleri (Guinea pig)
Description:P08587
Residue:690
Sequence:
MAEDLILERCDLQLEVNGRDHRTADLCRERLVLRRGQPFWLTLHFEGRGYEAGVDTLTFN
AVTGPDPSEEAGTMARFSLSSAVEGGTWSASAVDQQDSTVSLLLSTPADAPIGLYRLSLE
ASTGYQGSSFVLGHFILLYNPRCPADAVYMDSDQERQEYVLTQQGFIYQGSAKFINGIPW
NFGQFEDGILDICLMLLDTNPKFLKNAGQDCSRRSRPVYVGRVVSAMVNCNDDQGVLQGR
WDNNYSDGVSPMSWIGSVDILRRWKDYGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
FNSAHDQNSNLLIEYFRNESGEIEGNKSEMIWNFHCWVESWMTRPDLEPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGHLNVKYDAPFVFAEVNADVVNWIRQKDGSLRKSINHLV
VGLKISTKSVGRDEREDITHTYKYPEGSEEEREAFVRANHLNKLATKEEAQEETGVAMRI
RVGQNMTMGSDFDIFAYITNGTAESHECQLLLCARIVSYNGVLGPVCSTNDLLNLTLDPF
SENSIPLHILYEKYGDYLTESNLIKVRGLLIEPAANSYVLAERDIYLENPEIKIRVLGEP
KQNRKLIAEVSLKNPLPVPLLGCIFTVEGAGLTKDQKSVEVPDPVEAGEQAKVRVDLLPT
EVGLHKLVVNFECDKLKAVKGYRNVIIGPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM185752
n/a
NameBDBM185752
Synonyms:US9162991, 28a
TypeSmall organic molecule
Emp. Form.C18H11NO5
Mol. Mass.321.2836
SMILES[O-][N+](=O)c1ccc(\C=C\C(=O)c2cc3ccccc3oc2=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: