Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVoltage-dependent calcium channel gamma-8 subunit
LigandBDBM288301
Substrate/Competitorn/a
Meas. Tech.Calcium Flux Assay
pH7.4±n/a
IC50 0.050±n/a nM
Commentsextracted
Citation Ameriks MKGyuris MLaforteza BNLebold TPMeyer STRavula SSavall BMShireman BTWade WSGerencsér J Fused bicylic pyridine compounds and their use as AMPA receptor modulators US Patent  US10087185 Publication Date 10/2/2018
More Info.:Get all data from this article,  Assay Method
 
Voltage-dependent calcium channel gamma-8 subunit
Name:Voltage-dependent calcium channel gamma-8 subunit
Synonyms:CACNG6 | CACNG8 | Neuronal voltage-gated calcium channel gamma-8 subunit | TARP gamma-8 | Transmembrane AMPAR regulatory protein gamma-8
Type:Enzyme Catalytic Domain
Mol. Mass.:43326.96
Organism:Homo sapiens (Human)
Description:Q8WXS5
Residue:425
Sequence:
MESLKRWNEERGLWCEKGVQVLLTTVGAFAAFGLMTIAISTDYWLYTRALICNTTNLTAG
GDDGTPHRGGGGASEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEY
LLRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVY
ISANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIERSREAHCQSRS
DLLKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRSSEPSPSRDASPGGPGGPGFA
STDISMYTLSRDPSKGSVAAGLAGAGGGGGGAVGAFGGAAGGAGGGGGGGGGAGAERDRG
GASGFLTLHNAFPKEAGGGVTVTVTGPPAPPAPAPPAPSAPAPGTLAKEAAASNTNTLNR
KTTPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM288301
n/a
NameBDBM288301
Synonyms:5-[6-(Difluoromethyl)-2-(trifluoromethyl)pyrazolo[1,5-a]pyridin- | US10087185, Example 119
TypeSmall organic molecule
Emp. Form.C18H12F5N3O
Mol. Mass.381.2994
SMILESCc1cc(cc2CC(=O)Nc12)-c1c(ccc2cc(nn12)C(F)(F)F)C(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: