Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 1A (5HT1A)
LigandBDBM186927
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
pH7.4±n/a
Ki 0.6±n/a nM
Commentsextracted
Citation Besnard JHopkins ALGilbert IRuda GFAbecassis K Morpholino compounds, uses and methods US Patent  US9079895 Publication Date 7/14/2015
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 1A (5HT1A)
Name:Serotonin 1a (5-HT1a) receptor
Synonyms:5-HT1A | 5-hydroxytryptamine receptor 1A | Serotonin 1a (5-HT1a) receptor
Type:Enzyme
Mol. Mass.:46192.09
Organism:Mus musculus (Mouse)
Description:Q64264
Residue:421
Sequence:
MDMFSLGQGNNTTTSLEPFGTGGNDTGLSNVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKKGAGT
SFGTSSAPPPKKSLNGQPGSGDCRRSAENRAVGTPCANGAVRQGEDDATLEVIEVHRVGN
SKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
R
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM186927
n/a
NameBDBM186927
Synonyms:US9079895, 19s
TypeSmall organic molecule
Emp. Form.C21H26N2O2
Mol. Mass.338.4433
SMILESC(CN1CCO[C@H](COc2ccccc2)C1)N1CCc2ccccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: