Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-hydroxytryptamine receptor 7 (5HT7)
LigandBDBM186927
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
pH7.4±n/a
Ki 468±n/a nM
Commentsextracted
Citation Besnard JHopkins ALGilbert IRuda GFAbecassis K Morpholino compounds, uses and methods US Patent  US9079895 Publication Date 7/14/2015
More Info.:Get all data from this article,  Assay Method
 
5-hydroxytryptamine receptor 7 (5HT7)
Name:5-hydroxytryptamine receptor 7 (5HT7)
Synonyms:5-HT-7 | 5-HT-X | 5-HT7 | 5-hydroxytryptamine receptor 7 | 5HT7 | HTR7 | Serotonin 7 (5-HT7) receptor
Type:Enzyme
Mol. Mass.:49932.71
Organism:Mus musculus (Mouse)
Description:P32304
Residue:448
Sequence:
MMDVNSSGRPDLYGHLRSLILPEVGRRLQDLSPDGGAHSVVSSWMPHLLSGFPEVTASPA
PTWDAPPDNVSGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSN
YLIVSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVIS
IDRYLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDF
GYTIYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFSGFPRVQPESVISLNGVVKLQK
EVEECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTS
CSCIPLWVERTCLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHE
ALKLAERPERSEFVLQNCDHCGKKGHDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM186927
n/a
NameBDBM186927
Synonyms:US9079895, 19s
TypeSmall organic molecule
Emp. Form.C21H26N2O2
Mol. Mass.338.4433
SMILESC(CN1CCO[C@H](COc2ccccc2)C1)N1CCc2ccccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: