Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlpha-1D adrenergic receptor
LigandBDBM186927
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
pH7.4±n/a
Ki 2307±n/a nM
Commentsextracted
Citation Besnard JHopkins ALGilbert IRuda GFAbecassis K Morpholino compounds, uses and methods US Patent  US9079895 Publication Date 7/14/2015
More Info.:Get all data from this article,  Assay Method
 
Alpha-1D adrenergic receptor
Name:Alpha-1 adrenergic receptor
Synonyms:adrenergic Alpha2
Type:Enzyme
Mol. Mass.:59890.14
Organism:Mus musculus (Mouse)
Description:P97714
Residue:562
Sequence:
MTFRDILSVTFEGPRASSSTGGSGAGGGAGTVGPEGPAVGGVPGATGGSAVVGTGSGEDN
QSSTAEAGAAASGEVNGSAAVGGLVVSAQGVGVGVFLAAFILTAVAGNLLVILSVACNRH
LQTVTNYFIVNLAVADLLLSAAVLPFSATMEVLGFWPFGRTFCDVWAAVDVLCCTASILS
LCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWAVALVVSVGPLLGWKEPVPPDERFC
GITEEVGYAIFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGIKREPGKASEVVLRI
HCRGAATSAKGNPGTQSSKGHTLRSSLSVRLLKFSREKKAAKTLAIVVGVFVLCWFPFFF
VLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQCRRRRR
RLWPSLRPPLASLDRRPALRLCPQPAHRTPRGSPSPHCTPRPGLRRHAGGAGFGLRPSKA
SLRLREWRLLGPLQRPTTQLRAKVSSLSHKFRSGGARRAETACALRSEVEAVSLNVPQDG
AEAVICQAYEPGDLSNLRETDI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM186927
n/a
NameBDBM186927
Synonyms:US9079895, 19s
TypeSmall organic molecule
Emp. Form.C21H26N2O2
Mol. Mass.338.4433
SMILESC(CN1CCO[C@H](COc2ccccc2)C1)N1CCc2ccccc12 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: