BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetReceptor-interacting serine/threonine-protein kinase 1
LigandBDBM288690
Substrate/Competitorn/a
Meas. Tech.Kinase Assay of RIPK1
Temperature298.15±n/a K
Ki 460±n/a nM
Commentsextracted
Citation Zhang ZWang XSu YRuan HRen Y Necrosis inhibitors US Patent  US10092529 Publication Date 10/9/2018  Article
More Info.:Get all data from this article,  Assay Method
 
Receptor-interacting serine/threonine-protein kinase 1
Name:Mitogen-activated protein kinase 10/Receptor-interacting serine/threonine-protein kinase 1
Synonyms:RIP-1 | RIPK1 | Receptor-interacting protein 1
Type:Protein
Mol. Mass.:75926.99
Organism:Homo sapiens (Human)
Description:Q13546
Residue:671
Sequence:
MQPDMSLNVIKMKSSDFLESAELDSGGFGKVSLCFHRTQGLMIMKTVYKGPNCIEHNEAL
LEEAKMMNRLRHSRVVKLLGVIIEEGKYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIL
EIIEGMCYLHGKGVIHKDLKPENILVDNDFHIKIADLGLASFKMWSKLNNEEHNELREVD
GTAKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAVVLWAIFANKEPYENAICEQQLIMC
IKSGNRPDVDDITEYCPREIISLMKLCWEANPEARPTFPGIEEKFRPFYLSQLEESVEED
VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFA
PSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPF
AQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLD
PGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQ
IGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKN
CARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRID
LLSSLIYVSQN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM288690
n/a
NameBDBM288690
Synonyms:TC001287 | US10092529, Compound 15
TypeSmall organic molecule
Emp. Form.C16H23NO2
Mol. Mass.261.3593
SMILESCCC(C)(C)C(=O)N1C[C@H](O)C[C@H]1c1ccccc1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: