| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Apoptosis regulator Bcl-2 |
|---|
| Ligand | BDBM189804 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Time Resolved-Fluorescence Resonance Energy Transfer (TR-FRET) Assay |
|---|
| Temperature | 298.15±n/a K |
|---|
| Ki | <0.001±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Bruncko M; Ding H; Doherty GA; Elmore SW; Hasvold LA; Hexamer L; Kunzer AR; Song X; Souers AJ; Sullivan GM; Tao Z; Wang GT; Wang L; Wang X; Wendt MD; Mantei RA; Hansen TM Apoptosis-inducing agents for the treatment of cancer and immune and autoimmune diseases US Patent US9174982 Publication Date 11/3/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Apoptosis regulator Bcl-2 |
|---|
| Name: | Apoptosis regulator Bcl-2 |
|---|
| Synonyms: | Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | Bcl-2 Protein |
|---|
| Type: | Homodimer or heterodimer |
|---|
| Mol. Mass.: | 26269.11 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10415 |
|---|
| Residue: | 239 |
|---|
| Sequence: | MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
|
|
|
|---|
| BDBM189804 |
|---|
| n/a |
|---|
| Name | BDBM189804 |
|---|
| Synonyms: | US10213433, Compound 378 | US9174982, 378 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C45H50ClN7O8S |
|---|
| Mol. Mass. | 884.439 |
|---|
| SMILES | COC1(C)CCC(=C(CN2CCN(CC2)c2ccc(C(=O)NS(=O)(=O)c3ccc(NCC4CCOCC4)c(c3)[N+]([O-])=O)c(Oc3cnc4[nH]ccc4c3)c2)C1)c1ccc(Cl)cc1 |t:6| |
|---|
| Structure | 
|
|---|
Search and Browse
