Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptosis regulator Bcl-2
LigandBDBM189804
Substrate/Competitorn/a
Meas. Tech.Time Resolved-Fluorescence Resonance Energy Transfer (TR-FRET) Assay
Temperature298.15±n/a K
Ki<0.001±n/a nM
Commentsextracted
Citation Bruncko MDing HDoherty GAElmore SWHasvold LAHexamer LKunzer ARSong XSouers AJSullivan GMTao ZWang GTWang LWang XWendt MDMantei RAHansen TM Apoptosis-inducing agents for the treatment of cancer and immune and autoimmune diseases US Patent  US9174982 Publication Date 11/3/2015
More Info.:Get all data from this article,  Assay Method
 
Apoptosis regulator Bcl-2
Name:Apoptosis regulator Bcl-2
Synonyms:Apoptosis regulator Bcl-2 Protein | B-cell lymphoma 2 protein (Bcl-2) | BCL-2 | Bcl-2 Protein
Type:Homodimer or heterodimer
Mol. Mass.:26269.11
Organism:Homo sapiens (Human)
Description:P10415
Residue:239
Sequence:
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPA
ASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
LNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM189804
n/a
NameBDBM189804
Synonyms:US10213433, Compound 378 | US9174982, 378
TypeSmall organic molecule
Emp. Form.C45H50ClN7O8S
Mol. Mass.884.439
SMILESCOC1(C)CCC(=C(CN2CCN(CC2)c2ccc(C(=O)NS(=O)(=O)c3ccc(NCC4CCOCC4)c(c3)[N+]([O-])=O)c(Oc3cnc4[nH]ccc4c3)c2)C1)c1ccc(Cl)cc1 |t:6|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: