Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor EP4 subtype
LigandBDBM190273
Substrate/Competitorn/a
Meas. Tech.cAMP Assay
Temperature310.15±n/a K
EC50 0.61±n/a nM
Commentsextracted
Citation Barrett SDCiske FLColombo JMEndres GWGermain BDKornilov AKramer JBUzieblo AMaxey KM Difluorolactam compounds as EP4 receptor-selective agonists for use in the treatment of EP4-mediated diseases and conditions US Patent  US9180116 Publication Date 11/10/2015
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor EP4 subtype
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor EP4 subtype | PGE2 receptor EP4 subtype | PTGER2 | PTGER4 | Prostanoid EP4 receptor
Type:Enzyme
Mol. Mass.:53134.53
Organism:Homo sapiens (Human)
Description:P35408
Residue:488
Sequence:
MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
LNLSEKCI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM190273
n/a
NameBDBM190273
Synonyms:US9180116, 21C
TypeSmall organic molecule
Emp. Form.C21H27F2NO4
Mol. Mass.395.4402
SMILESCCCCC[C@H](O)\C=C\[C@H]1CC(F)(F)C(=O)N1CCc1ccc(cc1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: