Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEnoyl-ACP reductase (Wt ypFabV)
LigandBDBM50373349
Substrate/Competitorn/a
Meas. Tech.Inhibition Kinetics
IC50 2e+2± 0 nM
Citation Neckles CPschibul ALai CTHirschbeck MKuper JDavoodi SZou JLiu NPan PShah SDaryaee FBommineni GRLai CSimmerling CKisker CTonge PJ Selectivity of Pyridone- and Diphenyl Ether-Based Inhibitors for the Yersinia pestis FabV Enoyl-ACP Reductase. Biochemistry 55:2992-3006 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Enoyl-ACP reductase (Wt ypFabV)
Name:Enoyl-ACP reductase (Wt ypFabV)
Synonyms:n/a
Type:Protein
Mol. Mass.:43335.99
Organism:Yersinia pestis (Enterobacteria)
Description:n/a
Residue:399
Sequence:
MIIKPRVRGFICVTAHPTGCEANVKKQIDYVTTEGPIANGPKRVLVIGASTGYGLAARIT
AAFGCGADTLGVFFERPGEEGKPGTSGWYNSAAFHKFAAQKGLYAKSINGDAFSDEIKQL
TIDAIKQDLGQVDQVIYSLASPRRTHPKTGEVFNSALKPIGNAVNLRGLDTDKEVIKESV
LQPATQSEIDSTVAVMGGEDWQMWIDALLDAGVLAEGAQTTAFTYLGEKITHDIYWNGSI
GAAKKDLDQKVLAIRESLAAHGGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKG
THEGCIEQVYSLYKDSLCGDSPHMDQEGRLRADYKELDPEVQNQVQQLWDQVTNDNIYQL
TDFVGYKSEFLNLFGFGIDGVDYDADVNPDVKIPNLIQG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50373349
n/a
NameBDBM50373349
Synonyms:CHEMBL264417 | PT12
TypeSmall organic molecule
Emp. Form.C18H21NO4
Mol. Mass.315.3636
SMILESCCCCCCc1ccc(Oc2ccc(cc2)[N+]([O-])=O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: