Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHepsin
LigandBDBM191630
Substrate/Competitorn/a
Meas. Tech.High-Throughput Screening Assay
IC50 1930±390 nM
Citation Vasioukhin VIChevillet JR Hepsin inhibitors US Patent  US9182402 Publication Date 11/10/2015
More Info.:Get all data from this article,  Assay Method
 
Hepsin
Name:Hepsin
Synonyms:Serine protease hepsin | Transmembrane protease, serine 1
Type:Enzyme
Mol. Mass.:45016.98
Organism:Homo sapiens (Human)
Description:Human deglycosylated hepsin was expressed in Pichia pastoris.
Residue:417
Sequence:
MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSAD
ARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCV
DEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYH
GGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
YYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM191630
n/a
NameBDBM191630
Synonyms:US9182402, 3
TypeSmall organic molecule
Emp. Form.C19H12BrN3O3
Mol. Mass.410.221
SMILESBrc1cccc(c1)N1C(=O)NC(=O)\C(=C/c2c[nH]c3ccccc23)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: