Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHepsin
LigandBDBM50007260
Substrate/Competitorn/a
Meas. Tech.High-Throughput Screening Assay
IC50 430±50 nM
Citation Vasioukhin VIChevillet JR Hepsin inhibitors US Patent  US9182402 Publication Date 11/10/2015
More Info.:Get all data from this article,  Assay Method
 
Hepsin
Name:Hepsin
Synonyms:Serine protease hepsin | Transmembrane protease, serine 1
Type:Enzyme
Mol. Mass.:45016.98
Organism:Homo sapiens (Human)
Description:Human deglycosylated hepsin was expressed in Pichia pastoris.
Residue:417
Sequence:
MAQKEGGRTVPCCSRPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSAD
ARLMVFDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCV
DEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYH
GGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
YYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKTHSEASGMVTQL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007260
n/a
NameBDBM50007260
Synonyms:2,6-Di-tert-butyl-4-[1-(3,5-di-tert-butyl-4-hydroxy-phenylsulfanyl)-1-methyl-ethylsulfanyl]-phenol | 2,6-di(tert-butyl)-4-{1-[3,5-di(tert-butyl)-4-hydroxyphenylsulfanyl]-1-methylethylsulfanyl}phenol | 2,6-di(tert-butyl)-4-{1-[3,5-di(tert-butyl)-4-hydroxyphenylsulfanyl]-1-methylethylsulfanyl}phenol(probucol) | 2,6-di-tert-butyl-4-(2-(3,5-di-tert-butyl-4-hydroxyphenylthio)propan-2-ylthio)phenol | CHEMBL608 | DH-581 | Lorelco | PROBUCOL | US9182402, 14
TypeSmall organic molecule
Emp. Form.C31H48O2S2
Mol. Mass.516.842
SMILESCC(C)(Sc1cc(c(O)c(c1)C(C)(C)C)C(C)(C)C)Sc1cc(c(O)c(c1)C(C)(C)C)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: