Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin
LigandBDBM50041802
Substrate/Competitorn/a
Meas. Tech.High-Throughput Screening Assay
IC50 1260±300 nM
Citation Vasioukhin VIChevillet JR Hepsin inhibitors US Patent  US9182402 Publication Date 11/10/2015
More Info.:Get all data from this article,  Assay Method
 
Trypsin
Name:Trypsin
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:24411.24
Organism:Sus scrofa
Description:ChEMBL_1450738
Residue:231
Sequence:
FPTDDDDKIVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGE
HNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAA
GTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGFLEGGKDS
CQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50041802
n/a
NameBDBM50041802
Synonyms:1,8-dihydroxy-9(10H)-anthracenone | 1,8-dihydroxy-9-anthrone | 1,8-dihydroxyanthracen-9(10H)-one | 1,8-dihydroxyanthrone | CHEMBL46469 | US9182402, 15 | anthralin | cid_2202 | dithranol
TypeSmall organic molecule
Emp. Form.C14H10O3
Mol. Mass.226.2274
SMILESOc1cccc2Cc3cccc(O)c3C(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: