Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPhosphodiesterase 10A (PDE10A2)
LigandBDBM194104
Substrate/Competitorn/a
Meas. Tech.Fluorescence Polarization Assay
Ki 0.002±n/a nM
Citation Cox CDDudkin VYKim JJKuduk SDMcVean CAReger TSheen JTSteele T Triazolyl PDE10 inhibitors US Patent  US9200001 Publication Date 12/1/2015
More Info.:Get all data from this article,  Assay Method
 
Phosphodiesterase 10A (PDE10A2)
Name:Phosphodiesterase 10A (PDE10A2)
Synonyms:Phosphodiesterase 10A | Phosphodiesterase 10A2 | Phosphodiesterase 10A2 (PDE10A)
Type:Enzyme
Mol. Mass.:89387.03
Organism:Homo sapiens (Human)
Description:Q9Y233-2
Residue:789
Sequence:
MEDGPSNNASCFRRLTECFLSPSLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRK
NNKSEDESAPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKAD
GFALYFLGECNNSLCIFTPPGIKEGKPRLIPAGPITQGTTVSAYVAKSRKTLLVEDILGD
ERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWA
SVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALF
QVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADP
RFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCAL
ALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWQGLMQFTLPVRLCKEIELFHFDIG
PFENMWPGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAI
LQNNHTLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTV
SILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQS
HRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKD
EVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLSQWEKVIRGEETATWISSPSV
AQKAAASED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM194104
n/a
NameBDBM194104
Synonyms:US9200001, 18
TypeSmall organic molecule
Emp. Form.C28H26N6O2
Mol. Mass.478.545
SMILESCOc1ccc(Cc2nc(C)nn2-c2cc(\C=C\c3ccc4ccccc4n3)nc(C)n2)cc1OC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: