| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Ligand | BDBM194499 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Spectrophotometric Assay |
|---|
| pH | 7.4±n/a |
|---|
| Ki | 150±40 nM |
|---|
| Comments | extracted |
|---|
| Citation |  De Jersey, J; Guddat, LW; Hockova, D; Keough, DT 6-oxopurine phosphoribosyltransferase inhibitors US Patent US9200020 Publication Date 12/1/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Name: | Hypoxanthine-guanine phosphoribosyltransferase |
|---|
| Synonyms: | HGPRT | HGPRTase | HPRT | HPRT1 | HPRT_HUMAN | Hypoxanthine-guanine phosphoribosyltransferase | Hypoxanthine-guanine phosphoribosyltransferase (HGPRT) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24579.61 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00492 |
|---|
| Residue: | 218 |
|---|
| Sequence: | MATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDRTERLARDVMKEMGGH
HIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGD
DLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYKPDFVG
FEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA
|
|
|
|---|
| BDBM194499 |
|---|
| n/a |
|---|
| Name | BDBM194499 |
|---|
| Synonyms: | US9200020, Table 3 compound 8 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C12H20N6O6P |
|---|
| Mol. Mass. | 375.2976 |
|---|
| SMILES | Nc1nc2n(CCN(CCC(O)=O)CCP(O)(O)=O)c[nH]c2c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
