| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Xanthine-guanine phosphoribosyltransferase |
|---|
| Ligand | BDBM194504 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Spectrophotometric Assay |
|---|
| pH | 7.4±n/a |
|---|
| Ki | 27000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  De Jersey, J; Guddat, LW; Hockova, D; Keough, DT 6-oxopurine phosphoribosyltransferase inhibitors US Patent US9200020 Publication Date 12/1/2015 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Xanthine-guanine phosphoribosyltransferase |
|---|
| Name: | Xanthine-guanine phosphoribosyltransferase |
|---|
| Synonyms: | XGPT_ECOLI | Xanthine phosphoribosyltransferase (XGPRT) | gpp | gpt | gxu |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 16968.37 |
|---|
| Organism: | Escherichia coli (strain K12) |
|---|
| Description: | P0A9M5 |
|---|
| Residue: | 152 |
|---|
| Sequence: | MSEKYIVTWDMLQIHARKLASRLMPSEQWKGIIAVSRGGLVPGALLARELGIRHVDTVCI
SSYDHDNQRELKVLKRAEGDGEGFIVIDDLVDTGGTAVAIREMYPKAHFVTIFAKPAGRP
LVDDYVVDIPQDTWIEQPWDMGVVFVPPISGR
|
|
|
|---|
| BDBM194504 |
|---|
| n/a |
|---|
| Name | BDBM194504 |
|---|
| Synonyms: | US9200020, 2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H18N6O7P2 |
|---|
| Mol. Mass. | 396.2334 |
|---|
| SMILES | Nc1nc2n(CCN(CCP(O)(O)=O)CP(O)(O)=O)cnc2c(=O)[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
