Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophospholipase-like 1 (LYPLAL1)
LigandBDBM195572
Substrate/Competitorn/a
Meas. Tech.Gel-based ABPP (LYPLAL1)
pH7.5±n/a
IC50 21± 0 nM
Commentsextracted
Citation Ahn KBoehm MBrown MFCalloway JChe YChen JFennell KFGeoghegan KFGilbert AMGutierrez JAKalgutkar ASLanba ALimberakis CMagee TVO'Doherty IOliver RPabst BPandit JParris KPfefferkorn JARolph TPPatel RSchuff BShanmugasundaram VStarr JTVarghese AHVera NBVernochet CYan J Discovery of a Selective Covalent Inhibitor of Lysophospholipase-like 1 (LYPLAL1) as a Tool to Evaluate the Role of this Serine Hydrolase in Metabolism. ACS Chem Biol 11:2529-40 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophospholipase-like 1 (LYPLAL1)
Name:Lysophospholipase-like 1 (LYPLAL1)
Synonyms:n/a
Type:Protein
Mol. Mass.:26322.18
Organism:Homo sapiens (Human)
Description:n/a
Residue:237
Sequence:
MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPT
APPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILI
GGFSMGGCMAIHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADE
LVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM195572
n/a
NameBDBM195572
Synonyms:(R)-N,N-dimethyl-4'-(2-(2-phenylpiperidine-1-carbonyl)-2H-1,2,3-triazol-4-yl)-[1,1'-biphenyl]-4-sulfonamide (3)
TypeSmall organic molecule
Emp. Form.C28H29N5O3S
Mol. Mass.515.627
SMILESCN(C)S(=O)(=O)c1ccc(cc1)-c1ccc(cc1)-c1cnn(n1)C(=O)N1CCCC[C@@H]1c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: