Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl-CoA: cholesterol acyltransferase (ACAT)
LigandBDBM195571
Substrate/Competitorn/a
Meas. Tech.Gel-based ABPP (CES1)
pH7.5±n/a
IC50<5± 0 nM
Commentsextracted
Citation Ahn KBoehm MBrown MFCalloway JChe YChen JFennell KFGeoghegan KFGilbert AMGutierrez JAKalgutkar ASLanba ALimberakis CMagee TVO'Doherty IOliver RPabst BPandit JParris KPfefferkorn JARolph TPPatel RSchuff BShanmugasundaram VStarr JTVarghese AHVera NBVernochet CYan J Discovery of a Selective Covalent Inhibitor of Lysophospholipase-like 1 (LYPLAL1) as a Tool to Evaluate the Role of this Serine Hydrolase in Metabolism. ACS Chem Biol 11:2529-40 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acyl-CoA: cholesterol acyltransferase (ACAT)
Name:Acyl coenzyme A:cholesterol acyltransferase
Synonyms:Acyl coenzyme A:cholesterol acyltransferase | Serine hydrolase (CES1)
Type:Protein
Mol. Mass.:62520.83
Organism:Homo sapiens (Human)
Description:n/a
Residue:567
Sequence:
MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPL
GPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLN
IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF
HRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLK
MKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIP
MQLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDL
IADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPF
LKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLK
DKEVAFWTNLFAKKAVEKPPQTEHIEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM195571
n/a
NameBDBM195571
Synonyms:(R)-4'-(2-(2-phenylpiperidine-1-carbonyl)-2H-1,2,3-triazol-4-yl)-[1,1'-biphenyl]-4-carboxylic acid (2)
TypeSmall organic molecule
Emp. Form.C27H24N4O3
Mol. Mass.452.5045
SMILESOC(=O)c1ccc(cc1)-c1ccc(cc1)-c1cnn(n1)C(=O)N1CCCC[C@@H]1c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: