Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIsocitrate dehydrogenase [NADP] cytoplasmic
LigandBDBM195602
Substrate/Competitorn/a
Meas. Tech.Diaphorase/Resazurin Coupled Assay
Temperature298.15±n/a K
IC50>100000±0.0 nM
Commentsextracted
Citation Okoye-Okafor UCBartholdy BCartier JGao ENPietrak BRendina ARRominger CQuinn CSmallwood AWiggall KJReif AJSchmidt SJQi HZhao HJoberty GFaelth-Savitski MBantscheff MDrewes GDuraiswami CBrady PGroy ANarayanagari SRAntony-Debre IMitchell KWang HRKao YRChristopeit MCarvajal LBarreyro LPaietta EMakishima HWill BConcha NAdams NDSchwartz BMcCabe MTMaciejewski JVerma ASteidl U New IDH1 mutant inhibitors for treatment of acute myeloid leukemia Nat Chem Biol 11:878-86 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Isocitrate dehydrogenase [NADP] cytoplasmic
Name:Isocitrate dehydrogenase [NADP] cytoplasmic
Synonyms:Cytosolic NADP-isocitrate dehydrogenase | IDH | IDH1 | IDP | Isocitrate Dehydrogenase (IDH1) | Isocitrate dehydrogenase 1 (IDH1) | NADP(+)-specific ICDH | Oxalosuccinate decarboxylase | PICD
Type:Protein
Mol. Mass.:46661.29
Organism:Homo sapiens (Human)
Description:O75874
Residue:414
Sequence:
MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM195602
n/a
NameBDBM195602
Synonyms:GSK990
TypeSmall organic molecule
Emp. Form.C23H23N7O2
Mol. Mass.429.4744
SMILESCc1cccc(NC(=O)c2nn(Cc3c[nH]cn3)c3CCN(Cc23)C(=O)c2ccc[nH]2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: