| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Androgen-dependent TFPI-regulating protein |
|---|
| Ligand | BDBM195604 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Gel-based ABPP Assay |
|---|
| IC50 | 8.5e+3± 3.0e+3 nM |
|---|
| Citation |  Parsons, WH; Kolar, MJ; Kamat, SS; Cognetta, AB; Hulce, JJ; Saez, E; Kahn, BB; Saghatelian, A; Cravatt, BF AIG1 and ADTRP are atypical integral membrane hydrolases that degrade bioactive FAHFAs. Nat Chem Biol12:367-72 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Androgen-dependent TFPI-regulating protein |
|---|
| Name: | Androgen-dependent TFPI-regulating protein |
|---|
| Synonyms: | ADTRP | ADTRP_HUMAN | Androgen-dependent TFPI-regulating protein (ADTRP) | C6orf105 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 26858.19 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 230 |
|---|
| Sequence: | MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGV
TCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDT
VIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTW
VYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
|
|
|
|---|
| BDBM195604 |
|---|
| n/a |
|---|
| Name | BDBM195604 |
|---|
| Synonyms: | JJH260 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H34ClN5O5 |
|---|
| Mol. Mass. | 568.064 |
|---|
| SMILES | CN(C)c1ccc(cc1)C(=O)N1CCN2C(C1)C(=O)N(OC(=O)N1CCC(CCc3ccc(Cl)cc3)CC1)C2=O |
|---|
| Structure | 
|
|---|
Search and Browse
