Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific demethylase 5A (KDM5A)
LigandBDBM26106
Substrate/Competitorn/a
Meas. Tech.Demethylase AlphaScreen Assay
pH7.5±n/a
IC50 6.9e+3± 0 nM
Commentsextracted
Citation Johansson CVelupillai STumber ASzykowska AHookway ESNowak RPStrain-Damerell CGileadi CPhilpott MBurgess-Brown NWu NKopec JNuzzi ASteuber HEgner UBadock VMunro SLaThangue NBWestaway SBrown JAthanasou NPrinjha RBrennan PEOppermann U Structural analysis of human KDM5B guides histone demethylase inhibitor development. Nat Chem Biol 12:539-45 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific demethylase 5A (KDM5A)
Name:Lysine-specific demethylase 5A (KDM5A)
Synonyms:n/a
Type:Protein
Mol. Mass.:91593.17
Organism:Homo sapiens (Human)
Description:Human KDM5A (1-801 aa)
Residue:801
Sequence:
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPP
FACEVKSFRFTPRVQRLNELEAMTRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYAL
SKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
VQMPNLDLKEKVEPEVLSTDTQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQ
IFGAGPKVVGLAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNFVDLYVCMFCG
RGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGS
GFPVKDGRRKILPEEEEYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSF
CWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVN
HYRRLRRHCVFSHEELIFKMAADPECLDVGLAAMVCKELTLMTEEETRLRESVVQMGVLM
SEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDL
FRKLRDAVKEAETCASVAQLL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26106
n/a
NameBDBM26106
Synonyms:CHEMBL90852 | N-oxalyl glycine, 1a | NOG | Oxalylglycine | [(carboxymethyl)carbamoyl]formic acid
TypeSmall organic molecule
Emp. Form.C4H5NO5
Mol. Mass.147.0862
SMILESOC(=O)CNC(=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: