Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysine-specific demethylase 5D (KDM5D)
LigandBDBM26113
Substrate/Competitorn/a
Meas. Tech.Demethylase AlphaScreen Assay
pH7.5±n/a
IC50 2.5e+3± 0 nM
Commentsextracted
Citation Johansson CVelupillai STumber ASzykowska AHookway ESNowak RPStrain-Damerell CGileadi CPhilpott MBurgess-Brown NWu NKopec JNuzzi ASteuber HEgner UBadock VMunro SLaThangue NBWestaway SBrown JAthanasou NPrinjha RBrennan PEOppermann U Structural analysis of human KDM5B guides histone demethylase inhibitor development. Nat Chem Biol 12:539-45 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysine-specific demethylase 5D (KDM5D)
Name:Lysine-specific demethylase 5D (KDM5D)
Synonyms:n/a
Type:Protein
Mol. Mass.:89076.46
Organism:Homo sapiens (Human)
Description:Human KDM5D (1-775 aa)
Residue:775
Sequence:
MEPGCDEFLPPPECPVFEPSWAEFQDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEV
DNFRFTPRVQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERKILDLYSLSKIVI
EEGGYEAICKDRRWARVAQRLHYPPGKNIGSLLRSHYERIIYPYEMFQSGANHVQCNTHP
FDNEVKDKEYKPHSIPLRQSVQPSKFSSYSRRAKRLQPDPEPTEEDIEKHPELKKLQIYG
PGPKMMGLGLMAKDKDKTVHKKVTCPPTVTVKDEQSGGGNVSSTLLKQHLSLEPCTKTTM
QLRKNHSSAQFIDSYICQVCSRGDEDDKLLFCDGCDDNYHIFCLLPPLPEIPRGIWRCPK
CILAECKQPPEAFGFEQATQEYSLQSFGEMADSFKSDYFNMPVHMVPTELVEKEFWRLVS
SIEEDVTVEYGADIHSKEFGSGFPVSNSKQNLSPEEKEYATSGWNLNVMPVLDQSVLCHI
NADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMK
MLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYN
FAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAAFPETLDLNLAVAVHKEM
FIMVQEERRLRKALLEKGVTEAEREAFELLPDDERQCIKCKTTCFLSALACYDCPDGLVC
LSHINDLCKCSSSRQYLRYRYTLDELPTMLHKLKIRAESFDTWANKVRVALEVED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26113
n/a
NameBDBM26113
Synonyms:2,4 PDCA | cid_10365 | pyridine carboxylate, 6a | pyridine-2,4-dicarboxylic acid
TypeSmall organic molecule
Emp. Form.C7H5NO4
Mol. Mass.167.1189
SMILESOC(=O)c1ccnc(c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: