Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 4 (mGlu4)
LigandBDBM196914
Substrate/Competitorn/a
Meas. Tech.Pharmacological Assay
EC50 530±120 nM
Citation Acher FPin JGoudet CEschalier ABusserolles JRigault DLemasson ICesarini SCommare B Hypophosphorous acid derivatives having antihyperalgic activity and biological applications thereof US Patent  US9212196 Publication Date 12/15/2015
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 4 (mGlu4)
Name:Metabotropic glutamate receptor
Synonyms:GRM4 | Metabotropic glutamate receptor | mGlu4 | metabotropic glutamate 4 | metabotropic glutamate 4a
Type:Enzyme
Mol. Mass.:101849.79
Organism:Rattus norvegicus (Rat)
Description:P31423
Residue:912
Sequence:
MSGKGGWAWWWARLPLCLLLSLYAPWVPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKACGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTLASEGSYGESGVEAFIQ
KSRENGGVCIAQSVKIPREPKTGEFDKIIKRLLETSNARGIIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKSAPVLRLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHIKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNGSAEYKVIGSWTDHLHLRIERMQWPGSGQQLPRSICSLPCQPGERKKTVKGMACCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTSCQPIPIVKLEWDSPWAVLPLFLAVVGIA
ATLFVVVTFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFILISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLETPALAT
KQTYVTYTNHAI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM196914
n/a
NameBDBM196914
Synonyms:US9212196, Derivative 10
TypeSmall organic molecule
Emp. Form.C15H22NO8P
Mol. Mass.375.3108
SMILESCc1cc(cc(C)c1OCC(O)=O)C(O)P(O)(=O)CC[C@@H](N)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: