Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFlap endonuclease 1 (hFEN1-336Δ)
LigandBDBM50157840
Substrate/Competitorn/a
Meas. Tech.Steady-State Kinetics
pH7.5±n/a
IC50 46.4±4.8 nM
Commentsextracted
Citation Exell JCThompson MJFinger LDShaw SJDebreczeni JWard TAMcWhirter CSi÷berg CLMartinez Molina DAbbott WMJones CDNissink JWDurant STGrasby JA Cellularly active N-hydroxyurea FEN1 inhibitors block substrate entry to the active site. Nat Chem Biol 12:815-21 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Flap endonuclease 1 (hFEN1-336Δ)
Name:Flap endonuclease 1 (hFEN1-336Δ)
Synonyms:n/a
Type:Protein
Mol. Mass.:37858.07
Organism:Homo sapiens (Human)
Description:C-terminally truncated after residue 336
Residue:336
Sequence:
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAE
QEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDM
DCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRG
IGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSE
PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGST
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50157840
n/a
NameBDBM50157840
Synonyms:1-((2,3-dihydrobenzo[b][1,4]dioxin-2-yl)methyl)-3-hydroxythieno[3,2-d]pyrimidine-2,4(1H,3H)-dione (1) | 1-(2,3-Dihydro-benzo[1,4]dioxin-2-ylmethyl)-3-hydroxy-1H-thieno[3,2-d]pyrimidine-2,4-dione | CHEMBL361546
TypeSmall organic molecule
Emp. Form.C15H12N2O5S
Mol. Mass.332.331
SMILESOn1c(=O)n(CC2COc3ccccc3O2)c2ccsc2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: