Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver fatty acid binding protein (FABP1)
LigandBDBM22988
Substrate/CompetitorBDBM60925
Meas. Tech.FABP1 Fluorescent Ligand Displacement Assay
Ki 111± 3 nM
Citation Huang HMcIntosh ALMartin GGLandrock DChung SLandrock KKDangott LJLi SKier ABSchroeder F FABP1: A Novel Hepatic Endocannabinoid and Cannabinoid Binding Protein. Biochemistry 55:5243-55 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Liver fatty acid binding protein (FABP1)
Name:Liver fatty acid binding protein (FABP1)
Synonyms:n/a
Type:Protein
Mol. Mass.:14247.91
Organism:Mus musculus (Mouse)
Description:n/a
Residue:127
Sequence:
MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVR
NEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVY
KRVSKRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22988
BDBM60925
NameBDBM22988
Synonyms:(5Z,8Z,11Z,14Z)-N-(2-hydroxyethyl)icosa-5,8,11,14-tetraenamide | AEA | ANANDAMIDE | Arachidonoyl ethanolamide | Arachidonoyl ethanolamide (AEA) | Arachidonoylethanolamide (AEA) | Arachidonylethanolamide | CHEMBL15848 | [14C]Anandamide | [3H]Anandamide
Typeradiolabeled substrate
Emp. Form.C22H37NO2
Mol. Mass.347.5347
SMILESCCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(=O)NCCO
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: