Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein, liver |
---|
Ligand | BDBM197165 |
---|
Substrate/Competitor | BDBM60925 |
---|
Meas. Tech. | FABP1 Fluorescent Ligand Displacement Assay |
---|
Ki | 40± 3 nM |
---|
Citation | Huang, H; McIntosh, AL; Martin, GG; Landrock, D; Chung, S; Landrock, KK; Dangott, LJ; Li, S; Kier, AB; Schroeder, F FABP1: A Novel Hepatic Endocannabinoid and Cannabinoid Binding Protein. Biochemistry55:5243-55 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein, liver |
---|
Name: | Fatty acid-binding protein, liver |
Synonyms: | FABPL_MOUSE | Fabp1 | Fabpl | Liver fatty acid binding protein (FABP1) |
Type: | Protein |
Mol. Mass.: | 14247.91 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 127 |
Sequence: | MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVR
NEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVY
KRVSKRI
|
|
|
BDBM197165 |
---|
BDBM60925 |
---|
Name | BDBM197165 |
Synonyms: | 2-Oleoylmonoglycerol (2-OG) |
Type | Small organic molecule |
Emp. Form. | C21H40O4 |
Mol. Mass. | 356.5399 |
SMILES | CCCCCCCC\C=C/CCCCCCCC(=O)OC(CO)CO |
Structure |
|