Reaction Details |
| Report a problem with these data |
Target | Fatty acid-binding protein, liver |
---|
Ligand | BDBM50067499 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | FABP1 Fluorescent Ligand Displacement Assay |
---|
Ki | 8.5e+2±n/a nM |
---|
Citation | Huang, H; McIntosh, AL; Martin, GG; Landrock, D; Chung, S; Landrock, KK; Dangott, LJ; Li, S; Kier, AB; Schroeder, F FABP1: A Novel Hepatic Endocannabinoid and Cannabinoid Binding Protein. Biochemistry55:5243-55 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Fatty acid-binding protein, liver |
---|
Name: | Fatty acid-binding protein, liver |
Synonyms: | FABPL_MOUSE | Fabp1 | Fabpl | Liver fatty acid binding protein (FABP1) |
Type: | Protein |
Mol. Mass.: | 14247.91 |
Organism: | Mus musculus (Mouse) |
Description: | n/a |
Residue: | 127 |
Sequence: | MNFSGKYQLQSQENFEPFMKAIGLPEDLIQKGKDIKGVSEIVHEGKKIKLTITYGPKVVR
NEFTLGEECELETMTGEKVKAVVKLEGDNKMVTTFKGIKSVTELNGDTITNTMTLGDIVY
KRVSKRI
|
|
|
BDBM50067499 |
---|
n/a |
---|
Name | BDBM50067499 |
Synonyms: | (6aR,10aR)-3(1,1-dimethylheptyl)-9-hydroxymethyl)-6,6-dimethyl-6a,7,10,10a-tetrahydro-6H-benzo[c]chromen-1-ol | (6aR,10aR)-3-(1,1-dimethyl-heptyl)-9-hydroxymethyl-6,6-dimethyl-6a,7,10,10a-tetrahydro-6H-benzo[c]chromen-1-ol | (6aR,10aR)-9-(hydroxymethyl)-6,6-dimethyl-3-(2-methyloctan-2-yl)-6a,7,10,10a-tetrahydro-6H-benzo[c]chromen-1-ol | CHEMBL307696 | HU-210 | US9365534, HU-210 |
Type | Small organic molecule |
Emp. Form. | C25H38O3 |
Mol. Mass. | 386.5674 |
SMILES | CCCCCCC(C)(C)c1cc(O)c2[C@@H]3CC(CO)=CC[C@H]3C(C)(C)Oc2c1 |r,c:18| |
Structure |
|