| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nicotinamide N-methyltransferase |
|---|
| Ligand | BDBM60920 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | NNMT Enzymatic Activity Assay |
|---|
| pH | 8.6±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| Ki | 66000000±24000000 nM |
|---|
| Comments | extracted |
|---|
| Citation |  van Haren, MJ; Sastre Toraņo, J; Sartini, D; Emanuelli, M; Parsons, RB; Martin, NI A Rapid and Efficient Assay for the Characterization of Substrates and Inhibitors of Nicotinamide N-Methyltransferase. Biochemistry55:5307-15 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nicotinamide N-methyltransferase |
|---|
| Name: | Nicotinamide N-methyltransferase |
|---|
| Synonyms: | NNMT | NNMT_HUMAN | Nicotinamide N-methyltransferase | Nicotinamide N-methyltransferase (NNMT) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29571.16 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 264 |
|---|
| Sequence: | MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLI
DIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGN
RVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRAL
RNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQ
SYSSTMANNEGLFSLVARKLSRPL
|
|
|
|---|
| BDBM60920 |
|---|
| n/a |
|---|
| Name | BDBM60920 |
|---|
| Synonyms: | thionicotinamide |
|---|
| Type | n/a |
|---|
| Emp. Form. | C6H6N2S |
|---|
| Mol. Mass. | 138.19 |
|---|
| SMILES | NC(=S)c1cccnc1 |
|---|
| Structure | 
|
|---|
Search and Browse
