Reaction Details |
| Report a problem with these data |
Target | Nicotinamide N-methyltransferase |
---|
Ligand | BDBM60921 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | NNMT Enzymatic Activity Assay |
---|
pH | 8.6±n/a |
---|
Temperature | 310.15±n/a K |
---|
Ki | 202000000±54000000 nM |
---|
Comments | extracted |
---|
Citation | van Haren, MJ; Sastre Toraņo, J; Sartini, D; Emanuelli, M; Parsons, RB; Martin, NI A Rapid and Efficient Assay for the Characterization of Substrates and Inhibitors of Nicotinamide N-Methyltransferase. Biochemistry55:5307-15 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Nicotinamide N-methyltransferase |
---|
Name: | Nicotinamide N-methyltransferase |
Synonyms: | NNMT | NNMT_HUMAN | Nicotinamide N-methyltransferase | Nicotinamide N-methyltransferase (NNMT) |
Type: | Protein |
Mol. Mass.: | 29571.16 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 264 |
Sequence: | MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLI
DIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGN
RVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRAL
RNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQ
SYSSTMANNEGLFSLVARKLSRPL
|
|
|
BDBM60921 |
---|
n/a |
---|
Name | BDBM60921 |
Synonyms: | isoquinoline |
Type | n/a |
Emp. Form. | C9H7N |
Mol. Mass. | 129.1586 |
SMILES | c1ccc2cnccc2c1 |
Structure |
|