Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNicotinamide N-methyltransferase (NNMT)
LigandBDBM60924
Substrate/Competitorn/a
Meas. Tech.NNMT Enzymatic Activity Assay
pH8.6±n/a
Temperature310.15±n/a K
Ki 97000000±35000000 nM
Commentsextracted
Citation van Haren MJSastre Toraņo JSartini DEmanuelli MParsons RBMartin NI A Rapid and Efficient Assay for the Characterization of Substrates and Inhibitors of Nicotinamide N-Methyltransferase. Biochemistry 55:5307-15 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Nicotinamide N-methyltransferase (NNMT)
Name:Nicotinamide N-methyltransferase (NNMT)
Synonyms:NNMT | Nicotinamide N-methyltransferase
Type:Protein
Mol. Mass.:29571.16
Organism:Homo sapiens (Human)
Description:n/a
Residue:264
Sequence:
MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLI
DIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGN
RVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRAL
RNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQ
SYSSTMANNEGLFSLVARKLSRPL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM60924
n/a
NameBDBM60924
Synonyms:quinoline 3-carboxamide
Typen/a
Emp. Form.C10H8N2O
Mol. Mass.172.1833
SMILESNC(=O)c1cnc2ccccc2c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: