Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLow molecular weight phosphotyrosine protein phosphatase (LMWPTP)
LigandBDBM199180
Substrate/Competitorn/a
Meas. Tech.PTP pNPP Assay
pH7±n/a
Temperature298.15±n/a K
Ki>1000±0.0 nM
Commentsextracted
Citation Zhang ZZhang S Inhibitors of protein tyrosine phosphatases US Patent  US9217012 Publication Date 12/22/2015
More Info.:Get all data from this article,  Assay Method
 
Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Name:Low molecular weight phosphotyrosine protein phosphatase (LMWPTP)
Synonyms:3.1.3.2 | 3.1.3.48 | ACP1 | Adipocyte acid phosphatase | LMW-PTP | LMW-PTPase | LMWPTP | Low molecular weight cytosolic acid phosphatase | Low molecular weight phosphotyrosine protein phosphatase | Red cell acid phosphatase 1 | low molecular weight phosphotyrosine protein phosphatase isoform c
Type:n/a
Mol. Mass.:18042.81
Organism:Homo sapiens (Human)
Description:P24666
Residue:158
Sequence:
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSY
DPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM199180
n/a
NameBDBM199180
Synonyms:US9217012, 10
TypeSmall organic molecule
Emp. Form.C46H62F2N5O9P
Mol. Mass.897.9831
SMILESCCc1ccc(cc1)C(=O)NCCCCC(NC(=O)C(Cc1ccc(cc1)C(F)(F)P(O)(O)=O)NC(=O)C(Cc1ccccc1)NC(=O)COC1CC(C)CCC1C(C)C)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: