Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycine transporter 1
LigandBDBM202275
Substrate/Competitorn/a
Meas. Tech.Radioligand Binding Assay
Ki<0.1±n/a nM
Citation Pohlki FLange UAmberg WOchse MBehl BHornberger WMezler MHutchins CWTurner S Phenalkylamine derivatives, pharmaceutical compositions containing them, and their use in therapy US Patent  US9238619 Publication Date 1/19/2016
More Info.:Get all data from this article,  Assay Method
 
Glycine transporter 1
Name:Glycine transporter 1
Synonyms:GlyT-1 | GlyT1 | Glycine Transporters (GlyT1c) | Sodium- and chloride-dependent glycine transporter 1 | Sodium- and chloride-dependent glycine transporter 1 (GlyT1) | Sodium- and chloride-dependent glycine transporter 1 (GlyT1c) | Sodium-and chloride-dependent glycine transporter 1 (GlyT-1c) | Solute carrier family 6 member 9
Type:Enzyme
Mol. Mass.:78270.54
Organism:Homo sapiens (Human)
Description:P48067
Residue:706
Sequence:
MSGGDTRAAIARPRMAAAHGPVAPSSPEQVTLLPVQRSFFLPPFSGATPSTSLAESVLKV
WHGAYNSGLLPQLMAQHSLAMAQNGAVPSEATKRDQNLKRGNWGNQIEFVLTSVGYAVGL
GNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPMFKG
VGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTHDCAGVLDASNLTN
GSRPAALPSNLSHLLNHSLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLGVSWLV
VFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFDGIMYYLTPQWDKILEAKV
WGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFVIFSILGF
MANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGTQFCLLETL
VTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYAASFSLVVIS
CIMCVAIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILVFTVIQYQPITY
NHYQYPGWAVAIGFLMALSSVLCIPLYAMFRLCRTDGDTLLQRLKNATKPSRDWGPALLE
HRTGRYAPTIAPSPEDGFEVQPLHPDKAQIPIVGSNGSSRLQDSRI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM202275
n/a
NameBDBM202275
Synonyms:US9238619, 33
TypeSmall organic molecule
Emp. Form.C23H29FN4O3S
Mol. Mass.460.565
SMILESCN(C)CC(Cc1ccccc1)c1cc(OCCNS(=O)(=O)c2cnn(C)c2)ccc1F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: