Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetWith-No-Lysine (K) Kinase 3 (WNK3)
LigandBDBM203827
Substrate/Competitorn/a
Meas. Tech.In vitro MBP Phosphorylation Assay (MBP)
pH7.3±n/a
Temperature298.15±n/a K
IC50 6±0.0 nM
Commentsextracted
Citation Yamada KPark HMRigel DFDiPetrillo KWhalen EJAnisowicz ABeil MBerstler JBrocklehurst CEBurdick DACaplan SLCapparelli MPChen GChen WDale BDeng LFu FHamamatsu NHarasaki KHerr THoffmann PHu QYHuang WJIdamakanti NImase HIwaki YJain MJeyaseelan JKato MKaushik VKKohls DKunjathoor VLaSala DLee JLiu JLuo YMa FMo RMowbray SMogi MOssola FPandey PPatel SJRaghavan SSalem BShanado YHTrakshel GMTurner GWakai HWang CWeldon SWielicki JBXie XXu LYagi YIYasoshima KYin JYowe DZhang JHZheng GMonovich L Small-molecule WNK inhibition regulates cardiovascular and renal function. Nat Chem Biol 12:896-898 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
With-No-Lysine (K) Kinase 3 (WNK3)
Name:With-No-Lysine (K) Kinase 3 (WNK3)
Synonyms:n/a
Type:n/a
Mol. Mass.:47330.05
Organism:Homo sapiens (Human)
Description:Q9H4A3 1-434 aa Carna Biosciences, cat no. 05-181
Residue:434
Sequence:
MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHT
MDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPH
REETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLD
TETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLV
TELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEY
PYSECQNAAQIYRR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM203827
n/a
NameBDBM203827
Synonyms:N-(tert-butyl)-1-(1-(5-(5-(trifluoromethyl)-1,3,4-oxadiazol- 2-yl)pyridin-2-yl)piperidin-4-yl)-1H-imidazole-5-carboxamide | WNK463 | WNK463 (2)
TypeSmall organic molecule
Emp. Form.C22H25F3N6O2
Mol. Mass.462.4681
SMILESCC(C)(C)NC(=O)c1cncn1C1CCN(CC1)c1ccc(cc1)-c1nnc(o1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: