| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Complement factor D [24-253] |
|---|
| Ligand | BDBM203868 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Complement FD Thioesterolysis Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 5.8e+3± 8.5e+2 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Maibaum, J; Liao, SM; Vulpetti, A; Ostermann, N; Randl, S; Rüdisser, S; Lorthiois, E; Erbel, P; Kinzel, B; Kolb, FA; Barbieri, S; Wagner, J; Durand, C; Fettis, K; Dussauge, S; Hughes, N; Delgado, O; Hommel, U; Gould, T; Mac Sweeney, A; Gerhartz, B; Cumin, F; Flohr, S; Schubart, A; Jaffee, B; Harrison, R; Risitano, AM; Eder, J; Anderson, K Small-molecule factor D inhibitors targeting the alternative complement pathway. Nat Chem Biol12:1105-1110 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Complement factor D [24-253] |
|---|
| Name: | Complement factor D [24-253] |
|---|
| Synonyms: | CFAD_HUMAN | CFD | Complement factor D (FD) catalytic domain (Human fD) | DF | PFD |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24622.79 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00746 (24-253 aa) |
|---|
| Residue: | 230 |
|---|
| Sequence: | GRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAH
SLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVA
PGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDS
CKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA
|
|
|
|---|
| BDBM203868 |
|---|
| n/a |
|---|
| Name | BDBM203868 |
|---|
| Synonyms: | (S)-N2-benzhydryl-N1-(1-methyl-1H-indol-3-yl)pyrrolidine-1,2-dicarboxamide (5) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H28N4O2 |
|---|
| Mol. Mass. | 452.5475 |
|---|
| SMILES | Cn1cc(NC(=O)N2CCC[C@H]2C(=O)NC(c2ccccc2)c2ccccc2)c2ccccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
