| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Kallikrein-7 [37-253,Y180R] |
|---|
| Ligand | BDBM203865 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Human KLK7 Fluorescence-Lifetime Assay |
|---|
| pH | 5.6±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 8.7e+3± 4.6e+3 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Maibaum, J; Liao, SM; Vulpetti, A; Ostermann, N; Randl, S; Rüdisser, S; Lorthiois, E; Erbel, P; Kinzel, B; Kolb, FA; Barbieri, S; Wagner, J; Durand, C; Fettis, K; Dussauge, S; Hughes, N; Delgado, O; Hommel, U; Gould, T; Mac Sweeney, A; Gerhartz, B; Cumin, F; Flohr, S; Schubart, A; Jaffee, B; Harrison, R; Risitano, AM; Eder, J; Anderson, K Small-molecule factor D inhibitors targeting the alternative complement pathway. Nat Chem Biol12:1105-1110 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Kallikrein-7 [37-253,Y180R] |
|---|
| Name: | Kallikrein-7 [37-253,Y180R] |
|---|
| Synonyms: | KLK7 | KLK7_HUMAN | Kalligrein-7 Y180R (KLK7) | PRSS6 | SCCE |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23785.70 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P49862 (37-253 aa with Y180R mutation) |
|---|
| Residue: | 217 |
|---|
| Sequence: | ARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKAS
KSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPD
VTFPSDLMCVDVKLISPQDCTKVRKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQ
GLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
|
|
|
|---|
| BDBM203865 |
|---|
| n/a |
|---|
| Name | BDBM203865 |
|---|
| Synonyms: | Methyl (S)-2-((2-((3-(trifluoromethoxy)phenyl)carbamoyl)pyrrolidine-1-carboxamido)-methyl)benzoate (2) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H22F3N3O5 |
|---|
| Mol. Mass. | 465.4224 |
|---|
| SMILES | COC(=O)c1ccccc1CNC(=O)N1CCC[C@H]1C(=O)Nc1cccc(OC(F)(F)F)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
