| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bromodomain-containing protein 2 [348-455] |
|---|
| Ligand | BDBM205429 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Bromodomains Assay for DiscoveRx Gene Symbol |
|---|
| Kd | 18±0.0 nM |
|---|
| Citation |  Tanaka, M; Roberts, JM; Seo, HS; Souza, A; Paulk, J; Scott, TG; DeAngelo, SL; Dhe-Paganon, S; Bradner, JE Design and characterization of bivalent BET inhibitors. Nat Chem Biol12:1089-1096 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bromodomain-containing protein 2 [348-455] |
|---|
| Name: | Bromodomain-containing protein 2 [348-455] |
|---|
| Synonyms: | BET bromodomain 2(2) (BRD2(2)) | BRD2 | BRD2-BD2 | BRD2_HUMAN | Bromodomain-containing protein 2 (aa 348-455) | KIAA9001 | RING3 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 12751.52 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25440[348-455] |
|---|
| Residue: | 108 |
|---|
| Sequence: | EQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRD
YRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
|
|
|
|---|
| BDBM205429 |
|---|
| n/a |
|---|
| Name | BDBM205429 |
|---|
| Synonyms: | (R)-JQ1 (3) | US10407441, Compound (R)-JQ1 | US10925881, Name (R)-JQ1 | US11028051, Cmpd (+)-JQ1 | US11117865, Compound JQ1 | US11306105, Compound JQ1 | US11406645, Compound JQ1 | US11542273, Example (+)-JQ1 | US9320741, (R)-JQ1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H25ClN4O2S |
|---|
| Mol. Mass. | 456.988 |
|---|
| SMILES | Cc1nnc2[C@@H](CC(=O)OC(C)(C)C)N=C(c3c(C)c(C)sc3-n12)c1ccc(Cl)cc1 |r,c:14| |
|---|
| Structure | 
|
|---|
Search and Browse
