| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bromodomain testis-specific protein [21-137,251-382] |
|---|
| Ligand | BDBM205453 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Bromodomains Assay for DiscoveRx Gene Symbol |
|---|
| Ki | 0.076±0.0 nM |
|---|
| Citation |  Tanaka, M; Roberts, JM; Seo, HS; Souza, A; Paulk, J; Scott, TG; DeAngelo, SL; Dhe-Paganon, S; Bradner, JE Design and characterization of bivalent BET inhibitors. Nat Chem Biol12:1089-1096 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bromodomain testis-specific protein [21-137,251-382] |
|---|
| Name: | Bromodomain testis-specific protein [21-137,251-382] |
|---|
| Synonyms: | BRDT | BRDT_HUMAN | Bromodomain testis (1, 2) (BRDT(1,2)) |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 29512.81 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q58F21 (BRDT, 21-137 and 251-382) |
|---|
| Residue: | 249 |
|---|
| Sequence: | NTKKNGRLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIK
KRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEEKNV
LPDSQQQYNVVKTVKVTEQLRHCSEILKEMLAKKHFSYAWPFYNPVDVNALGLHNYYDVV
KNPMDLGTIKEKMDNQEYKDAYKFAADVRLMFMNCYKYNPPDHEVVTMARMLQDVFETHF
SKIPIEPVE
|
|
|
|---|
| BDBM205453 |
|---|
| n/a |
|---|
| Name | BDBM205453 |
|---|
| Synonyms: | MTI (35) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C54H66Cl2N10O9S2 |
|---|
| Mol. Mass. | 1134.199 |
|---|
| SMILES | Cc1sc-2c(c1C)C(=NC(CC(=O)NCCOCCOCCOCCOCCOCCOCCOCCNC(=O)C[C@@H]1N=C(c3c(C)c(C)sc3-n3c(C)nnc13)c1ccc(Cl)cc1)c1nnc(C)n-21)c1ccc(Cl)cc1 |r,c:8,43| |
|---|
| Structure | 
|
|---|
Search and Browse
