Reaction Details |
| Report a problem with these data |
Target | Bromodomain testis-specific protein [21-137] |
---|
Ligand | BDBM205430 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | AlphaScreen BRD Binding Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 2.36±0.0 nM |
---|
Comments | extracted |
---|
Citation | Tanaka, M; Roberts, JM; Seo, HS; Souza, A; Paulk, J; Scott, TG; DeAngelo, SL; Dhe-Paganon, S; Bradner, JE Design and characterization of bivalent BET inhibitors. Nat Chem Biol12:1089-1096 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bromodomain testis-specific protein [21-137] |
---|
Name: | Bromodomain testis-specific protein [21-137] |
Synonyms: | BRDT | BRDT_HUMAN | Bromodomain testis 1 (BRDT(1)) |
Type: | n/a |
Mol. Mass.: | 13934.55 |
Organism: | Homo sapiens (Human) |
Description: | Q58F21 (BRDT, 21-137) |
Residue: | 117 |
Sequence: | NTKKNGRLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIK
KRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE
|
|
|
BDBM205430 |
---|
n/a |
---|
Name | BDBM205430 |
Synonyms: | (6S+2S)-PEG0 (6) |
Type | Small organic molecule |
Emp. Form. | C41H38Cl2N10O4S2 |
Mol. Mass. | 869.841 |
SMILES | COC(=O)C[C@@H]1N=C(c2c(C)c(sc2-n2c(C)nnc12)C(=O)NCCNC(=O)C[C@@H]1N=C(c2c(C)c(C)sc2-n2c(C)nnc12)c1ccc(Cl)cc1)c1ccc(Cl)cc1 |r,c:6,33| |
Structure |
|