Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain testis 1 (BRDT(1))
LigandBDBM205434
Substrate/Competitorn/a
Meas. Tech.AlphaScreen BRD Binding Assay
pH7.5±n/a
Temperature298.15±n/a K
IC50 1.09±0.0 nM
Commentsextracted
Citation Tanaka MRoberts JMSeo HSSouza APaulk JScott TGDeAngelo SLDhe-Paganon SBradner JE Design and characterization of bivalent BET inhibitors. Nat Chem Biol 12:1089-1096 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bromodomain testis 1 (BRDT(1))
Name:Bromodomain testis 1 (BRDT(1))
Synonyms:n/a
Type:n/a
Mol. Mass.:13934.55
Organism:Homo sapiens (Human)
Description:Q58F21 (BRDT, 21-137)
Residue:117
Sequence:
NTKKNGRLTNQLQYLQKVVLKDLWKHSFSWPFQRPVDAVKLQLPDYYTIIKNPMDLNTIK
KRLENKYYAKASECIEDFNTMFSNCYLYNKPGDDIVLMAQALEKLFMQKLSQMPQEE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM205434
n/a
NameBDBM205434
Synonyms:(6S+2S)-PEG4 (10)
TypeSmall organic molecule
Emp. Form.C49H54Cl2N10O8S2
Mol. Mass.1046.051
SMILESCOC(=O)C[C@@H]1N=C(c2c(C)c(sc2-n2c(C)nnc12)C(=O)NCCOCCOCCOCCOCCNC(=O)C[C@@H]1N=C(c2c(C)c(C)sc2-n2c(C)nnc12)c1ccc(Cl)cc1)c1ccc(Cl)cc1 |r,c:6,45|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: