| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Inorganic pyrophosphatase |
|---|
| Ligand | BDBM205473 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Colorimetric Malachite Green Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 2.21e+5± 4.4e+4 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Pang, AH; Garzan, A; Larsen, MJ; McQuade, TJ; Garneau-Tsodikova, S; Tsodikov, OV Discovery of Allosteric and Selective Inhibitors of Inorganic Pyrophosphatase from Mycobacterium tuberculosis. ACS Chem Biol11:3084-3092 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Inorganic pyrophosphatase |
|---|
| Name: | Inorganic pyrophosphatase |
|---|
| Synonyms: | IPYR_ECOLI | Inorganic pyrophosphatase (EcPPiase) | ppa |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 19696.77 |
|---|
| Organism: | Escherichia coli (Enterobacteria) |
|---|
| Description: | P0A7A9 |
|---|
| Residue: | 176 |
|---|
| Sequence: | MSLLNVPAGKDLPEDIYVVIEIPANADPIKYEIDKESGALFVDRFMSTAMFYPCNYGYIN
HTLSLDGDPVDVLVPTPYPLQPGSVIRCRPVGVLKMTDEAGEDAKLVAVPHSKLSKEYDH
IKDVNDLPELLKAQIAHFFEHYKDLEKGKWVKVEGWENAEAAKAEIVASFERAKNK
|
|
|
|---|
| BDBM205473 |
|---|
| n/a |
|---|
| Name | BDBM205473 |
|---|
| Synonyms: | PPiase inhibitor, 17 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H44N6 |
|---|
| Mol. Mass. | 488.7106 |
|---|
| SMILES | CCCCN(CCCC)c1nc(nc(n1)-c1cccn1CCCc1ccccc1)N1CCCCCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
