Reaction Details |
| Report a problem with these data |
Target | Acyl-protein thioesterase 2 [H152R] |
---|
Ligand | BDBM207991 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Steady-State Kinetic Assays |
---|
pH | 6.5±n/a |
---|
Ki | >10000±n/a nM |
---|
Comments | extracted |
---|
Citation | Won, SJ; Davda, D; Labby, KJ; Hwang, SY; Pricer, R; Majmudar, JD; Armacost, KA; Rodriguez, LA; Rodriguez, CL; Chong, FS; Torossian, KA; Palakurthi, J; Hur, ES; Meagher, JL; Brooks, CL; Stuckey, JA; Martin, BR Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2). ACS Chem Biol11:3374-3382 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Acyl-protein thioesterase 2 [H152R] |
---|
Name: | Acyl-protein thioesterase 2 [H152R] |
Synonyms: | APT2 | Acyl-protein thioesterase 2 (APT2 H152R) | LYPA2_HUMAN | LYPLA2 |
Type: | Protein |
Mol. Mass.: | 24759.78 |
Organism: | Homo sapiens (Human) |
Description: | Human APT2 with H152R mutation |
Residue: | 231 |
Sequence: | MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGG
FSQGGALSLYTALTCPHPLAGIVALSCWLPLRRAFPQAANGSAKDLAILQCHGELDPMVP
VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
|
|
|
BDBM207991 |
---|
n/a |
---|
Name | BDBM207991 |
Synonyms: | ML348 |
Type | Small organic molecule |
Emp. Form. | C18H17ClF3N3O3 |
Mol. Mass. | 415.794 |
SMILES | FC(F)(F)c1ccc(Cl)c(NC(=O)CN2CCN(CC2)C(=O)c2ccco2)c1 |
Structure |
|