| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Acyl-protein thioesterase 2 [P86Q] |
|---|
| Ligand | BDBM207992 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Steady-State Kinetic Assays |
|---|
| pH | 6.5±n/a |
|---|
| Ki | 130±10 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Won, SJ; Davda, D; Labby, KJ; Hwang, SY; Pricer, R; Majmudar, JD; Armacost, KA; Rodriguez, LA; Rodriguez, CL; Chong, FS; Torossian, KA; Palakurthi, J; Hur, ES; Meagher, JL; Brooks, CL; Stuckey, JA; Martin, BR Molecular Mechanism for Isoform-Selective Inhibition of Acyl Protein Thioesterases 1 and 2 (APT1 and APT2). ACS Chem Biol11:3374-3382 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Acyl-protein thioesterase 2 [P86Q] |
|---|
| Name: | Acyl-protein thioesterase 2 [P86Q] |
|---|
| Synonyms: | APT2 | Acyl-protein thioesterase 2 (APT2 P86Q) | LYPA2_HUMAN | LYPLA2 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 24771.24 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Human APT2 with P86Q mutation |
|---|
| Residue: | 231 |
|---|
| Sequence: | MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAP
RIPVTLNMKMVMPSWFDLMGLSPDAQEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGG
FSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVP
VRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
|
|
|
|---|
| BDBM207992 |
|---|
| n/a |
|---|
| Name | BDBM207992 |
|---|
| Synonyms: | ML349 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H22N2O4S2 |
|---|
| Mol. Mass. | 454.562 |
|---|
| SMILES | COc1ccc(cc1)N1CCN(CC1)C(=O)c1cc2CS(=O)(=O)c3ccccc3-c2s1 |
|---|
| Structure | 
|
|---|
Search and Browse
