Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetApoptosis regulator Bcl-XL
LigandBDBM209184
Substrate/Competitorn/a
Meas. Tech.FL5.12 Cellular Assay
EC50 30±n/a nM
Citation Wang LDoherty GWang XTao ZBruncko MKunzer ARWendt MDSong XFrey RHansen TMSullivan GMJudd ASouers A Apoptosis-inducing agents for the treatment of cancer and immune and autoimmune diseases US Patent  US9266877 Publication Date 2/23/2016
More Info.:Get all data from this article,  Assay Method
 
Apoptosis regulator Bcl-XL
Name:Apoptosis regulator Bcl-XL
Synonyms:n/a
Type:Protein
Mol. Mass.:26122.63
Organism:Mus musculus (Mouse)
Description:Q64373
Residue:233
Sequence:
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP
WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM209184
n/a
NameBDBM209184
Synonyms:US9266877, 130
TypeSmall organic molecule
Emp. Form.C36H34N6O3S
Mol. Mass.630.759
SMILESCc1c(cc(C#N)n1CC1CCCCC1)-c1ccc(nc1C(O)=O)N1CCc2cccc(C(=O)Nc3nc4ccccc4s3)c2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: