| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-like protein 1 |
|---|
| Ligand | BDBM209197 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | FL5.12 Cellular Assay |
|---|
| EC50 | 19±n/a nM |
|---|
| Citation |  Wang, L; Doherty, G; Wang, X; Tao, Z; Bruncko, M; Kunzer, AR; Wendt, MD; Song, X; Frey, R; Hansen, TM; Sullivan, GM; Judd, A; Souers, A Apoptosis-inducing agents for the treatment of cancer and immune and autoimmune diseases US Patent US9266877 Publication Date 2/23/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bcl-2-like protein 1 |
|---|
| Name: | Bcl-2-like protein 1 |
|---|
| Synonyms: | Apoptosis regulator Bcl-XL | B2CL1_MOUSE | Bcl2l | Bcl2l1 | Bclx |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 26122.63 |
|---|
| Organism: | Mus musculus (Mouse) |
|---|
| Description: | Q64373 |
|---|
| Residue: | 233 |
|---|
| Sequence: | MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEP
WIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
|
|
|
|---|
| BDBM209197 |
|---|
| n/a |
|---|
| Name | BDBM209197 |
|---|
| Synonyms: | US9266877, 143 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C36H30N6O3S |
|---|
| Mol. Mass. | 626.727 |
|---|
| SMILES | CN(c1ccccc1)c1nccc(c1C)-c1ccc(nc1C(O)=O)N1CCc2cccc(C(=O)Nc3nc4ccccc4s3)c2C1 |
|---|
| Structure | 
|
|---|
Search and Browse
