Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEphrin type-A receptor 2 (EPHA2)
LigandBDBM209860
Substrate/Competitorn/a
Meas. Tech.HotSpot Kinase Activity Assay
IC50 17±0.0 nM
Citation Heinzlmeir SKudlinzki DSreeramulu SKlaeger SGande SLLinhard VWilhelm MQiao HHelm DRuprecht BSaxena KMédard GSchwalbe HKuster B Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs. ACS Chem Biol 11:3400-3411 (2016) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ephrin type-A receptor 2 (EPHA2)
Name:Ephrin type-A receptor 2 (EPHA2)
Synonyms:n/a
Type:Protein
Mol. Mass.:34367.96
Organism:Homo sapiens (Human)
Description:EPHA2 truncation (596-900 aa); 519U
Residue:305
Sequence:
DPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEK
QRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQ
LVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTS
GGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFR
LPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRL
PSTSG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM209860
n/a
NameBDBM209860
Synonyms:4-[[(3S)-3-(dimethylamino)pyrrolidin-1-yl]methyl]-N-[4-methyl-3-[(5-pyrimidin-5-ylpyrimidin-2-yl)amino]phenyl]-3-(trifluoromethyl)benzamide | Bafetinib
TypeSmall organic molecule
Emp. Form.C30H31F3N8O
Mol. Mass.576.6153
SMILESCN(C)[C@H]1CCN(Cc2ccc(cc2C(F)(F)F)C(=O)Nc2ccc(C)c(Nc3ncc(cn3)-c3cncnc3)c2)C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: